8I7OJ2

In situ structure of axonemal doublet microtubules in mouse sperm with 16-nm repeat
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
171
structure length
171
Chain Sequence
YGLSQITASLFISNSAVANDKLTLSNNHITTIINVSAEVVNTFFEDIQYVQVPVSDAPNSYLYDFFDPIADHIHGVEMRNGRTLLHCAAGVSRSATLCLAYLMKYHNMTLLDAHTWTKTCRPIIRPNNGFWEQLIHYEFKLFSRNTVRMIYSPIGLIPNIYEKEAYLMELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-cell structural insight into the stability of sperm microtubule doublet
rcsb
molecule tags Structural protein
molecule keywords Tektin-1
total genus 36
structure length 171
sequence length 171
chains with identical sequence J3
ec nomenclature ec 3.1.3.16: protein-serine/threonine phosphatase.
pdb deposition date 2023-02-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...