8I7UA

Crystal structure of alpha-oxoamine synthase alb29 with plp cofactor
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
394
structure length
394
Chain Sequence
VKKLRHLSDGYWDSAARLGVHGAVLQAVPGGRLSAPDGRVAVNMSSYSYLGLDESPRIIDAAIAALRSNMVLNSSLGRVRMTLPLLEEAECALGDLFGADVATLNSCSAAAWATLPVLASGLLTDGVAPVMVFDKRAHFCMASLKSLCADETRVETIRHNDVDALADICRKNKRVAYVCDSVYSTGGTLAPLEELFALQKEFGLFLYFDEAHSTSVIGDMGRGYVLDRMGAINDSTMLITSLNKGFGASGGAIVFGPRDDDRKRKIIQRSSGPLMWSQRLNTPALGAIIESAKLHRSEALPELQAKLHSNIALFDGLVRAAGQGNSVPIRYLELGSEVDTLEASAYLFDNGFYVEPDFFPIVSRGAAGLRARIRSSMSTADIEQFAHVWHKLGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mechanistic investigations on CC bond forming alpha-oxoamine synthase allowing L-glutamate as substrate.
pubmed doi rcsb
molecule keywords 8-amino-7-oxononanoate synthase
molecule tags Transferase
source organism Streptomyces albogriseolus 1-36
total genus 138
structure length 394
sequence length 394
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2023-02-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...