8I9EE

S-rbd(omicron ba.3) in complex with pd of ace2
Total Genus 15

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
179
structure length
167
Chain Sequence
FDEVFNATRFASVYAWNRKRISDYSVLYNFAPFFTFKCYGVSFTNVYADSFVIRGNEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVSGNYNYLYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGFNCYFPLRSYGFRPTYGVGHQPYRVVVLSFE
2040608010012014016016014012010080604020
051015Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/viral protein
source organism Homo sapiens
publication title Structural basis for the enhanced infectivity and immune evasion of Omicron subvariants
rcsb
molecule keywords Processed angiotensin-converting enzyme 2
total genus 15
structure length 167
sequence length 179
ec nomenclature
pdb deposition date 2023-02-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.