8I9YLB

Cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - ytm1-2
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
380
structure length
356
Chain Sequence
GSLAFLPRKRAARHRGRVKSFPKDDPKKPVHLTAAMGYKAGMTTIVRDLDRPGAKAHKKEVVEAVTIIDCPPMVVVGLVGYIETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYAKKYAENNGASITRELERIKKYCTVVRVLAHTQIRKTPLKQKKAHLMEIQINGGSVADKVEFGRSLFEKPVTIDTIFEKDEMIDVIAVTKGHGFVGVTARWGTKQWTVARAGQMGYHHRTSVNHKIYRIGKGDDEANASTETDLTKKKITPMGGFVRYGEVNNDYVMIKGSVPGVKKRIMTLRKSLFTHTSRKALEKVELKWIDTSSEFGHGAFQTAAEKKQFMGTLKKDLQTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.
pubmed doi rcsb
molecule keywords RNA (3341-MER)
molecule tags Ribosome
total genus 79
structure length 356
sequence length 380
ec nomenclature
pdb deposition date 2023-02-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...