8IAMC

Cryo-em structure of the yeast spt-orm2 (orm2-s3d) complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
72
structure length
69
Chain Sequence
HKSSMVYIPTTKEAKRRNGGILNTIEEVVEKLYWTYYIHLPFYLMASFDSFFLHVFFLTIFSLSFFGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Collaborative regulation of yeast SPT-Orm2 complex by phosphorylation and ceramide.
pubmed doi rcsb
molecule tags Transferase/inhibitor
source organism Arabidopsis thaliana
molecule keywords Chimera of Long chain base biosynthesis protein 1 and Serine palmitoyltransferase 1
total genus 21
structure length 69
sequence length 72
chains with identical sequence G
ec nomenclature
pdb deposition date 2023-02-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...