8IDOC

Crystal structure of nanobody vhh-t148 with mers-cov rbd
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
QVQLQESGGGSVQAGGSLKLSCSVSGYTYSTYCIAWFRQVPGKEREGLAFIKNPEGNTDYADSVQGRFFISQDTVDNTVYLSMNSLKPEDTATYYCAGAVSNWVCGMSIKSQGYGMDYWGKGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures and neutralizing mechanisms of camel nanobodies targeting the receptor-binding domain of MERS-CoV spike glycoprotein
rcsb
molecule tags Viral protein
source organism Middle east respiratory syndrome-related coronavirus
molecule keywords Spike protein S1
total genus 31
structure length 128
sequence length 128
chains with identical sequence D
ec nomenclature
pdb deposition date 2023-02-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...