8IH8C

Anti-sigmaf factor and anti-sigmaf factor antagonist complex(usfx-rsfb)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
QRGVRAVELNVAARLENLALLRTLVGAIGTFEDLDFDAVADLRLAVDEVCTRLIRSALPDATLRLVVDPRKDEVVVEASAACDTHDVVAPGSFSWHVLTALADDVQTFHDGRQPDVAGSVFGITLTARR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High resolutions crystal structure of anti-sigmaF factor and Anti-sigmaF factor antagonist complex(usfx-RsfB)
rcsb
molecule tags Transcription
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule keywords Anti-sigma-F factor antagonist RsfB
total genus 37
structure length 129
sequence length 129
chains with identical sequence D
ec nomenclature ec ?:
pdb deposition date 2023-02-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...