8IHNM

Cryo-em structure of the rpd3s core complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
507
structure length
357
Chain Sequence
LEKDSKGNIIKLNEPSTISEDSKVSVTGLPLNKGPSEKIKENEDFCSACNQSGSFLCCDTCPKSFHFLCLDPPIDPNNLPKGDWHCNECKFKIFINNSMATLKKIESNFIKQNNNVKIFAKLLFNIDSHNPKQFQLPNYIKETFPAVKTGSRGQYSDENDKIPLTDRQLFNTSYGQSITKLDSYNPDTHIDSNSGKFLICYKCNQTRLGSWSHPENSRLIMTCDYCQTPWHLDCVPRASFKNLGSKWKCPLHSPTKVYKKIHHVNYKVWKKQRLINKKNQLYYEPLQKIGYQNNGNIQIIPTNQDFKITQIDENSIKYDFFDKIYKSKMVQKRKLFQFQESLIDKLGSQNGNSEDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Histone H3
publication title Structural basis for nucleosome binding and catalysis by the yeast Rpd3S/HDAC holoenzyme.
pubmed doi rcsb
source organism Xenopus laevis
total genus 50
structure length 357
sequence length 507
chains with identical sequence O
ec nomenclature ec ?:
pdb deposition date 2023-02-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...