8ILKA

Crystal structure of a highly photostable and bright green fluorescent protein at ph8.5
Total Genus 58

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
215
structure length
214
Chain Sequence
MASTPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNEVQHIPRDDGVECPVTLLYPLLSDKSKCVEAHQNTICKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHICQSETLEAHL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS1 (4-14)S2 (17-28)TI1 (28-31)TI2 (29-32)3H2 (61-63)S11 (206-216)S10 (188-197)S3 (33-40)3H1 (49-55)TI8 (199-202)S4 (82-90)S9 (165-176)S6 (108-118)S5 (95-105)AH1 (73-77)TVIa1 (77-80)TI7 (176-179)TIV2 (78-81)TI6 (161-164)TI4 (121-124)TII2 (90-93)TIV3 (104-107)AH2 (125-128)S7 (137-144)S8 (147-157)TI5 (158-161)TIV1 (13-16)TI3 (40-43)TII1 (67-70)TI'3 (144-147)Updating...
connected with : NaN
molecule tags Fluorescent protein
publication title Crystal structure of a highly photostable and bright green fluorescent protein.
rcsb
molecule keywords Green FLUORESCENT PROTEIN
total genus 58
structure length 214
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-03-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.