8ILLA

Crystal structure of a highly photostable and bright green fluorescent protein at ph5.6
Total Genus 56

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
214
structure length
213
Chain Sequence
ASTPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNEVQHIPRDDGVECPVTLLYPLLSDKSKCVEAHQNTICKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHICQSETLEAHL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (4-14)TIV1 (13-16)S2 (17-28)TI3 (40-43)TI2 (29-32)S11 (206-216)TI1 (28-31)S3 (33-40)S10 (188-197)TI11 (199-202)3H1 (49-52)TI4 (52-55)S4 (82-90)S9 (165-176)EMPTYTI5 (53-56)S5 (95-105)AH1 (73-77)TII1 (67-70)TVIII2 (176-179)TVIa1 (77-80)TI6 (78-81)TII2 (90-93)TI10 (161-164)S6 (108-118)AH2 (125-128)TI7 (121-124)S8 (147-157)TI8 (144-147)S7 (137-144)TVIII1 (159-162)TIV2 (104-107)3H2 (61-63)TI9 (158-161)Updating...
connected with : NaN
molecule tags Fluorescent protein
publication title Crystal structure of a highly photostable and bright green fluorescent protein
rcsb
molecule keywords green fluorescent protein
total genus 56
structure length 213
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-03-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.