8IPCA

The recombinant nz-1 fab complexed with the pdz tandem fragment of a. aeolicus s2p homolog with the pa14 tag inserted between the residues 181 and 184
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
186
Chain Sequence
VPKYLKEPVVVGYVQRDSIAQKIGIKPGDKIIKIGYEVRTWEDLRDALIRLSLDGVKETTLFLEREGGVAMPGAEDDVVEVLHLTIKVPNVQKGEELGIAPLVKPVVGGVKKGSPADQVGIKPGDLILEVNGKKINTWYELVEEVRKSQGKAIKLKILRNGKMIEKELIPAKDPKTGTYFIGLFPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recombinant production of antibody antigen-binding fragments with an N-terminal human growth hormone tag in mammalian cells.
pubmed doi rcsb
molecule tags Immune system/hydrolase
source organism Rattus norvegicus
molecule keywords The recombinantly-expressed heavy chain of the monoclonal antibody NZ-1
total genus 35
structure length 186
sequence length 187
ec nomenclature
pdb deposition date 2023-03-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...