8IR9F

Xfel structure of cyanobacterial photosystem ii following one flash (1f) with a 30-microsecond delay
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
34
structure length
34
Chain Sequence
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Oxygen-evolving photosystem II structures during S1-S2-S3 transitions.
doi rcsb
molecule tags Photosynthesis
source organism Thermostichus vulcanus
molecule keywords Photosystem II protein D1
total genus 11
structure length 34
sequence length 34
chains with identical sequence f
ec nomenclature
pdb deposition date 2023-03-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...