8IRQA

Larimichthys crocea ifnd
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
161
structure length
150
Chain Sequence
SCRWVDHKFRQHSETSLDLLNTMANNSTVAFPNDLYSQASKASAEDKLHFTVQVLEEAAALFEEDHSNASWEENTVENFVNVVNQQADGLRSCTGSHGHKKKNKKLHMYFKRLSSHVLKKMSHSAEAWELIRKEIRTHLMRADQLVSSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of large yellow croaker IFNd at 1.49 Angstrom resolution.
rcsb
molecule keywords Interferon d
molecule tags Cytokine
source organism Larimichthys crocea
total genus 66
structure length 150
sequence length 161
ec nomenclature ec ?:
pdb deposition date 2023-03-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...