8IUDA

Crystal structure of bacterial defense protein gajb
Total Genus 174
50100150200250300350400450050100150
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
493
structure length
473
Chain Sequence
SREQIIKDGGNILVTALVSKIEADLKENKTHYSIAAVTFTNKAAKEIEGRLGNFIGTNDGFVESEIIRPFIKDAFGNDYPDNFTAEYFDNQFASYDKGLQVLKYQNILGTYSNPKKNFKFQLALDILKKSLVARQYIFSKYFKIFIDEYQDSDKDMHNLFMYLKDQLKIKLFIVGDPWRGAEPENFNGLIENSTDFNKYHLTSNFRCCQDIQNYSNLFNEETRSLIKEKNEVQNVISIADDMPISDILLKLTEEKQVLNIEAELVILVRRRNQAIEIMKELNEEGFNFIFIPQTPLDRATPNATLLKEVIKYVKNDRYSIYDLAAEIVGNLSSREIKEIQKIINELLVPNINQVLINQVLINLFAKLEITLDTREITAFTEVMMTNEFDIAFDTNEYLHKIFTVHSAKGLEFNQVIITASDYNVHYNRDTNEHYVATTRAKDKLIVIMDNKKYSDYIETLMKELKIKNIIKSI
50100150200250300350400450400300200100
050100150Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
source organism Bacillus cereus (strain vd045)
publication title Structural and functional investigation of GajB protein in Gabija anti-phage defense.
pubmed doi rcsb
molecule keywords Gabija protein GajB
total genus 174
structure length 473
sequence length 493
ec nomenclature
pdb deposition date 2023-03-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.