8IUJ6B

Cryo-em structure of euglena gracilis super-complex iii2+iv2, composite
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
282
structure length
282
Chain Sequence
MEGFVDKIDDNKYLGKWETILTDGRTHLPKHITFHDAAAISARWNQQYVNDSGPVYYRHWLACQQTYGAGNEDCRKLRWWAQQITHPLHLAEWDDWWKDEHYDLQIGQHWNRICGEEFEEASNLLKDLKEKREGLAAKFRDLLKTKTAEDPMGKILHEVAQLEEPSKTPVADLVEAGTLSKEAVEAAAALKIKELKALRDDATWAEVKGSLLNGVTTTCSTLKKTSKVVAELKAQAELERNKTSAVKLDIPHMRVNYEKPGLYEYDTWFGKFLPRTPQFGFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Electron transport
molecule keywords MPP-beta
publication title Euglena's Atypical Respiratory Chain Adapts to the Discoidal Cristae and Flexible Metabolism
rcsb
total genus 88
structure length 282
sequence length 282
chains with identical sequence 6b
ec nomenclature
pdb deposition date 2023-03-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...