8IW5A

Crystal structure of liprin-beta h2h3 dimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
48
structure length
48
Chain Sequence
GSMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAEVLIEWLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title KANK1 shapes focal adhesions by orchestrating protein binding, mechanical force sensing, and phase separation.
pubmed doi rcsb
molecule tags Protein binding
source organism Mus musculus
molecule keywords Liprin-beta-1
total genus 17
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-03-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...