8J2WA

Saccharothrix syringae photocobilins protein, dark state
Total Genus 136
50100150200250300020406080100120140
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
339
structure length
330
Chain Sequence
DILAAGREELMAALAEGDEHAAVDLAMRLLDGGVPADVVLLELVADAQVEIGVLWQANRWSVAQEHAATAISERVIAAVGDRAAAAPTRGHVVVACLDGEWHALPARIVAEVLRGRGWRVTFLGASVPAAHLVPYLEEHGPDAVALSCTLPRGLPRADQVVAACRATGTPVLVGGLGFGPDGRWARVLGAGTWAPTARAAADLLDRPEPRPADPEYAALRARRAELVDAGLAALHEWFPPLRDYDARRLDATLDDLGDIVDHLAASVYVDDPELFGEFVTWTAEVLAARGVSPASVEVALEAIARVLDDHPRTRHHLDHGRRALAAHLEH
5010015020025030030025020015010050
020406080100120Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
source organism Saccharothrix syringae
publication title Photocobilins integrate B12 and bilin photochemistry for enzyme control.
pubmed doi rcsb
molecule keywords Cobalamin-binding protein
total genus 136
structure length 330
sequence length 339
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-04-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.