8J49B

Crystal structure of la
Total Genus 23

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
100
structure length
100
Chain Sequence
EERVGDMRIVNITFSDINSIKNFQPFSQYFDFTLTGPRYNGNIAQFAMIWKIKNPPHNLLGVFFDNNTRDDEDDKYTLEELKQMGNGAKNMYIFWQYEQK

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Plant protein
source organism Arabidopsis thaliana
publication title Molecular basis of SAP05-mediated ubiquitin-independent proteasomal degradation of transcription factors
doi rcsb
molecule keywords Squamosa promoter-binding-like protein 5
total genus 23
structure length 100
sequence length 100
chains with identical sequence D
ec nomenclature ec ?:
pdb deposition date 2023-04-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.