8J4GA

Crystal structure of 11jd mutant-i62n
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
271
structure length
271
Chain Sequence
EPHSVRYFHTAVSEPSPGVPQFVSVGYLDGEAFVYYDSETRRKEPRADWTSAIDDQQYWERNTRISQNNEQIYRVNLETLRERYNQSRGSHTWQRMYGCDLLEDGSIRGFDQYGYEGRDFIALDKDTRTFTAADAGAQITKRKWEEEGTFAETMKFYLENTCIEWLRKYVSYGKDVLERRERPEVRVSGMEADKILTLSCRAHGFYPRPISISWLKDGVVQEQETQRGSTVPNSDGTYHIWATIDVLPGDRDKYQCRVEHASLPQPGLFSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of duck MHC 11JD mutant-I62N
rcsb
molecule keywords MHC class I antigen
molecule tags Immune system
source organism Anas platyrhynchos
total genus 66
structure length 271
sequence length 271
chains with identical sequence D
ec nomenclature
pdb deposition date 2023-04-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...