8J4HA

X-ray structure of a ferric ion-binding protein a (fbpa) from vibrio metschnikovii in complex with danshensu (dss)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
309
structure length
309
Chain Sequence
QDITLYSGRGETLVKPIIEQFEKQSGIKVNVRYGDTAQLAVLLQEEGARSPADVYWGQDAGAMGALANAGLLATLPEAVYKQLPEIYTSKTGQWVAASGRSRVIAYSTERASAEDIPASVFDLTSEKYQGRFGLAPTNGGFQSFVTAMRVQHGDEKTLAWLKAMKANQPKIYRNNTTQIQAIGDGEIDFALVNNYYLPRFVAANASFPAKQTYFAEGDIGNLVNVAGVAVLKSSKKQPQAIQFIEYMLSPAAQQYFTSVVGEYPVTQGIIPNPVLGELDTLLQAAPSIDLDQLADLQGTLKLLRDAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Ferric iron ABC transporter iron-binding protein
publication title Molecular Mechanism of Fe 3+ Binding Inhibition to Vibrio metschnikovii Ferric Ion-Binding Protein, FbpA, by Rosmarinic Acid and its Hydrolysate, Danshensu.
pubmed doi rcsb
source organism Vibrio metschnikovii
total genus 107
structure length 309
sequence length 309
ec nomenclature ec ?:
pdb deposition date 2023-04-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...