8J5JA

The crystal structure of bat coronavirus rsyn04 rbd bound to the antibody s43
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
192
structure length
192
Chain Sequence
LCPFSQVFNATRFPSVYAWTRERISNCIADYSVLYNSTSFSTFRCYGVSPTKLNDLCFSNVYADSMVVRGDEVRQIAPSQTGVIADYNYKLPDDFTGCVIAWNSKAKDENGQYFYRLFRKSKLLPFQRDVSNVTYGSGKNDGCNPSEADCYWPLLKYGFTSSVSQDYQPYRVVVLSFELLNAPATVCGPKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cross-species recognition of bat coronavirus RsYN04 and cross-reaction of SARS-CoV-2 antibodies against the virus.
pubmed doi rcsb
molecule tags Viral protein/immune system
source organism Betacoronavirus sp.
molecule keywords Spike protein S1
total genus 40
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2023-04-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...