8J64B

Crystal structure of toxoplasma gondii mic2-m2ap complex
Total Genus 7

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
49
structure length
49
Chain Sequence
AGASCTYVWSDWNKCVCPMGYQARHAAVKFDYRNKPCDLPTFETKACSC

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell invasion
source organism Toxoplasma gondii
publication title Structural insights into MIC2 recognition by MIC2-associated protein in Toxoplasma gondii.
pubmed doi rcsb
molecule keywords MIC2-associated protein
total genus 7
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2023-04-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.