8J67A

Crystal structure of toxoplasma gondii m2ap
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
180
structure length
177
Chain Sequence
FLELVEVPCNSVHVQGVMTPNQMVKVTGAGWDNGVLEFYVTRPTKDTSRSHLASIMCYSKDIDGVPSDKAGKCFLKRFSGEDSSEIDEKEVSLPIKSHNDAFMFVCSSNDGSALQCDVFALDNTNSNDGWKVNTVDLGVSVSPDLAFGLTADGVKVKKLYASSGLTAINDDPSLGCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into MIC2 recognition by MIC2-associated protein in Toxoplasma gondii.
pubmed doi rcsb
molecule keywords MIC2-associated protein
molecule tags Cell invasion
source organism Toxoplasma gondii
total genus 40
structure length 177
sequence length 180
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2023-04-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...