8J7FA

Ion channel
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
289
structure length
289
Chain Sequence
WLPHQRKVFDFYASQGVQYFTAFLIVSNFIFNCAEKEWDPYTDQLYQGLWRWGEFAFNTMFLIELLINFYGIAFCFWRYNWAWNTFDLVVVAIGTLTMAEAIGGNFMPPSMALIRNLRAFRIFRLFKRIKSLNKIIVSLGKAIPGVANAFVIMVIIMCIYAILGVEFYHMTGSDGTYVTYNDNVKRGLCTGDEVELGQCSLNQTVSSETARGYTYGEEYYGTFFRALYTLFQVLTGESWSEAVARPAVFESHYDSFGPVLFYVSFIIICQIVLINVVVAVLLDKMVEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title structure of ion channel
rcsb
molecule keywords ion channel,Voltage dependent ion channel,Green fluorescent protein (Fragment),Voltage dependent ion channel,Green fluorescent protein (Fragment),Ion transport domain-containing protein
molecule tags Transport protein
source organism Homo sapiens
total genus 98
structure length 289
sequence length 289
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2023-04-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...