8J86C

Monkeypox virus dna replication holoenzyme f8, a22 and e4 complex in a dna binding form
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
423
structure length
350
Chain Sequence
TSSADLTNLKELLSLYKSLRFSAIEKYNSLVEWGTSTYWKIGVQKTSISDYYLPVYFGSVFIYSKGMVELGSGNSFQIPDEIRSACNKVLDSDNGIDFLRFVLLNNRWIMEDAISQSPVNIFKLASEYGLNIPNYLEYSIMERSFDDTFPKISISYIMYIESIKVDRIGDNIFIPSVITKGKKILVKDVDHLIRSKVREHTFVKVKKKNTFSILGEVIKRIIDTIGRDYYVNGKYFSKVGIAGLKQLTNKLDINECVDELVDEINKSGTVKRKIKNQSVFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYGNFNQFVSIFNTVTDVKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of DNA replication machinery from human monkeypox virus in complex with a DNA duplex
rcsb
molecule tags Viral protein
source organism Monkeypox virus
molecule keywords DNA polymerase
total genus 72
structure length 350
sequence length 423
ec nomenclature
pdb deposition date 2023-04-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...