8J9HA6

Cryo-em structure of euglena gracilis respiratory complex i, deactive state
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
423
structure length
423
Chain Sequence
SVRAAGGQYVLPDHGRYGQVVRPARLEEFELNPHQNPSRDRDWSVEIRGFYRDLLKSIPTMKQRFRLVIPNDVVRQNIRKRFEQGPKLTDPAALRHRALMVSADLEEYFREDFLDSQVQGKYNNMDPRTLLNQEIAAAASETQTAHRFFNEGTNVLLETGIGGEDVTENRVYITREQAYRKGLASLRGDAAVRHLLPAVDPANQTTLQALAAENDLQALVDLLGHLPAAKTAEAYVQRCEAFHKEAGLRHQKASGGAVLAAWEKFKDEEVNSTVLLHPAYKALIADPSRNPLLRGAADWVRLVEAGGLSTTEPDSAADKLLKVAQHLYYSDQLPEGFAQDLGVSYLADLKGVDRRLDLLLDEEIAYRQELLLKIYAHTVESIKATASNPTDPAAVKKHLDAHDWSAFVVPTEGVKSSYEALAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Euglena's Atypical Respiratory Chain Adapts to the Discoidal Cristae and Flexible Metabolism
rcsb
molecule tags Electron transport
molecule keywords NDUS1A
total genus 117
structure length 423
sequence length 423
ec nomenclature
pdb deposition date 2023-05-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...