8JB9A

Solution structure of anti-crispr protein acriic5
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
130
Chain Sequence
MNNSIKFHVSYDGTARALFNTKEQAEKYCLVEEINDEMNGYKRKSWEEKLREENCASVQDWVEKNYTSSYSDLFNICEIEVSSAGQLVKIDNTEVDDFVENCYGFTLEDDLEEFNKAKQYLQKFYAECEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural mechanism of Cas9 inhibition by AcrIIC5 from prophages in Simonsiella muelleri
rcsb
molecule tags Protein binding
source organism Simonsiella muelleri
molecule keywords Type II-C anti-CRISPR protein, AcrIIC5
total genus 31
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2023-05-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...