8JBEB

Cryoem structure of metazoan mon1-ccz1-rmc1 complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
480
structure length
391
Chain Sequence
QRVEITLRSFYIFNSTFGQVEGEEHKKVLFYHPNDIELNTKIKDVGLSEAIIRFTGTFTSEDDCQALHTQKTTQLFYQPEPGYWLVLVLNVPKEVRVADYRGAEISDRIYRAILRQCYQMFRFQNGCFSNPDKRRELLCQKLLQFYDQDPAQCDIIDMLHSIQYLPLDKTLFLRAQNFGTLCETFPDIKESIMLYQEQVLCGGKLSPEDLHCVHSYVVQHVLKVGGFVRSRPMKVYVTLDKEAKPYYLLIYRALHITLCLFLNADQVAPKQDLYDDLHAYMAPQLTSLARDISSELTKEAPKYLFINEQSLQHHTNFNVLSIIADLANGSGAPAEEVQVKTTNDYWIVKRRCNYRQYYVILCNSKATLLDVTQEARRIFEQELTDDVFFDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title CryoEM Structure of metazoan Mon1-Ccz1-RMC1 complex
rcsb
molecule tags Signaling protein
source organism Drosophila
molecule keywords MIP05619p
total genus 82
structure length 391
sequence length 480
ec nomenclature
pdb deposition date 2023-05-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...