8JGUA

Crystal structure of n-terminal domain of exopolyphosphatase from deinococcus radiodurans
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
310
structure length
310
Chain Sequence
MRVAVADVGTNSSHLLIAEALPGDAGGFRVIDTLKDRTRLGECLDTRGELTPEGEERLASALTRFRELAASAGAGDVRVYATSALREAPNGAEVAERVRQRTGLYPAVISGVREGELTYLGVREAVELGPDNVLLDLGGGSLEFVRGAEERAADVLSLPLGAIRMTRAFPEGDGKNAGRDVADAVARQVRELLRPHAGRFAARPGTQFFLSSGTAEAAADAIAQRRGGRPAEAAGGVNGERFTLTELADLLAHVARLRPAQRARVPGLERRGDTILAALSVLHAALDALGAREVTVSEGALREGMLIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Evolution of Bacterial Polyphosphate Degradation Enzyme for Phosphorus Cycling.
pubmed doi rcsb
molecule keywords Exopolyphosphatase
molecule tags Hydrolase
source organism Deinococcus radiodurans r1 = atcc 13939 = dsm 20539
total genus 100
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 2023-05-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...