8JIVCJ

Atomic structure of wheat ribosome reveals unique features of the plant ribosomes
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
169
structure length
167
Chain Sequence
QLNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDTGIYGMDFFVVLERAGYRVSRRRRCKARVGIHQRVTKEDAMKWFQVKYEGVILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.
pubmed doi rcsb
molecule keywords 25S rRNA
molecule tags Ribosome
total genus 37
structure length 167
sequence length 169
ec nomenclature ec ?:
pdb deposition date 2023-05-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...