8JIVCa

Atomic structure of wheat ribosome reveals unique features of the plant ribosomes
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
144
structure length
141
Chain Sequence
TTRFKKNRKKRGHVSAGHGRVGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLSNRFYTPTVNVERLWSMVPSEKAAEAKAPVVDVSQFGYFKVLGKGMLPEKPIVVKAKLISKIAEKKIKAAGGAVVLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 25S rRNA
total genus 28
structure length 141
sequence length 144
ec nomenclature ec ?:
pdb deposition date 2023-05-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...