8JIVCi

Atomic structure of wheat ribosome reveals unique features of the plant ribosomes
Total Genus 26

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
SQPKSGLFVGINKGHVVTKRELPPRPSDRKGKGTKRVHFVRNLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRS

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
publication title Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.
pubmed doi rcsb
molecule keywords 25S rRNA
total genus 26
structure length 99
sequence length 99
ec nomenclature ec ?:
pdb deposition date 2023-05-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.