8JJRB

Cryo-em structure of symbiodinium photosystem i
Total Genus 53
2040608010012014016018001020304050
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
185
structure length
185
Chain Sequence
AVGVCLPLTDKFDPLNLASTDEKLERYTQVEIKHGRVAMIAVVGYIMPEIFRFPGCESFQHGLAALESIPLEGWVQLAALVGAHEVLVKPRAGGLGTSDFGLGTELLDGIEEPELERKLTAERNNGRLAMVAIMGLMVQDGMFGEPPLSYMSKNGWWGEGVQYFVQHLNNCQSFSGSFVDNAGVC

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Photosynthesis
publication title Architecture of symbiotic dinoflagellate photosystem I-light-harvesting supercomplex in Symbiodinium.
pubmed doi rcsb
molecule keywords PCPI-7
total genus 53
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2023-05-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.