8JJRU

Cryo-em structure of symbiodinium photosystem i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
137
structure length
104
Chain Sequence
SETFRRRRISEIKNGRVAMIACMGYIAPEYFRWPGYCSPSTDLKFADIPNGIQALYKMPAEAWAQIGVFIAFLELFRRGLEAEINNGRLAMVAITGMISQNAFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Architecture of symbiotic dinoflagellate photosystem I-light-harvesting supercomplex in Symbiodinium.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords PCPI-7
total genus 37
structure length 104
sequence length 137
ec nomenclature
pdb deposition date 2023-05-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...