8JKZB

Cryo-em structure of the prokaryotic sparsa system complex
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
469
structure length
469
Chain Sequence
LSQLAAHSTIPEPLLLFKDNRTDTHPLRGLSQYGPYSACFNLPGQVRLAYLAPTEHMRKLDAIVRELQNPATPKEATNYYVEYGGFEKVFKVPLVMPQEHLRCLALDECHGVAANGNGLALADKIVQSMSGLFRQKHAFDVLLVYLPASWKKCFEYDGFDLHDRIKAKVAPLNLPIQIINDTALTRQCRANVMWGVSVALYAKAGGIPWKLADWDKDEAYIGLSYAIKKNAEGQEYTTCCSQVFDPDGTGFEFVAYDTREFITDRKGNPYLSYQEMQSVLSKSLHLYQSSHNGRMPRKIFIHKTTHFTEDEIQGAFDSFSSSTEIELVQIIQSTNWYGLKVDGKKGDKPVAPASYPVDRGLYQPLTESECLLWTQGSVMGVNQQNPGQPVFKEAALTPLPNPIMLRRFSGNGGWHATCSSILALTKVDWNNNTLYKKLPVTLVYSQVFADVVKQTPEIVNEIYDYRFFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of antiphage immunity generated by a prokaryotic Argonaute-associated SPARSA system.
pubmed doi rcsb
molecule keywords Sir2 superfamily protein
molecule tags Antiviral protein
source organism Geobacter sulfurreducens
total genus 99
structure length 469
sequence length 469
ec nomenclature ec ?:
pdb deposition date 2023-06-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...