8JRTe

Cryo-em structure of human 26s proteasomal rp subcomplex (ea state) bound to k11/k48-branched ubiquitin (ub) chain composed of three ub.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
45
Chain Sequence
MSEKKQPVDLGLLEEDNWDDDNVEDDFSNQLRAELEKHGYKMETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-EM structure of human 26S proteasomal RP subcomplex bound with branched Ub chain.
rcsb
molecule keywords 26S protease regulatory subunit 7
molecule tags Cytosolic protein
source organism Homo sapiens
total genus 7
structure length 45
sequence length 70
ec nomenclature
pdb deposition date 2023-06-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...