8JW3A

The crystal structure of the viral terpene synthase from orpheovirus ihumi-lcc2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
275
structure length
275
Chain Sequence
YFQGMEKFYNQFQSYPLSLHPNTSLFNTKTKNLAQKYGLRYPSDLSNLTGYVYPYLSPSALQVSNNWHAFLWFLDDKIDDPDCPKVEKEIILNHIIEYLSNKCKASHPITQFLDDEEMWLQYKESKCRFECERQAILMIQKGMIPKWDKEDYTVHEYEKIRFYDSGCETVWPLMFLDDGILPQYGVYTKFGNTIVCRVNDLYSYAKDVYRDKSNYNYFVYYMQENNCHLDEVINIVTEEVKNKWHMLKNANNNTAERVNYWCLGNLVWHHASERY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Function and Structure of a Terpene Synthase Encoded in a Giant Virus Genome.
pubmed doi rcsb
molecule tags Lyase
source organism Orpheovirus ihumi-lcc2
molecule keywords Terpenoid synthase
total genus 113
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2023-06-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...