8JWNA

Crystal structure of akrtyl-nadph complex
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
331
structure length
330
Chain Sequence
MEYTQLGRIGLKVSRLVLGTMNFGPTTDEAESHAIMDAALDAGINFFDTANVYGWGENKGRTEEILGSWFAQGGDRRDKVVLATKVYGNMGLGPAWPNHDKLSALNIRRSVDASLKRLGTDHIDLYQFHHVDRDTPWDEIWQAMDVLVRQGKILYVGSSNFAGWNIAQANETAARHGRLGLVSEQCLYNLCERRAEMEVVPAAREYGLGVIAWSPLHGGLLGGAIRKEQEGGNRRAASGRAADALKDPQQREQIQRYEDLLDKHGLEPGEVALAWLLTRPGVTGPIVGPRTADQLASAVRAAELTLTDEVLTALDEIFPGPGPSPEAFAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Aldo/keto reductase
publication title A three-level regulatory mechanism of the aldo-keto reductase subfamily AKR12D.
pubmed doi rcsb
source organism Streptomyces xinghaiensis
total genus 124
structure length 330
sequence length 331
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2023-06-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...