8JWOA

Crystal structure of akrtyl-tylosin complex
Total Genus 115

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
299
Chain Sequence
MEYTQLGRIGLKVSRLVLGTDEAESHAIMDAALDAGINFFDTANENKGRTEEILGSWFAQGGDRRDKVVLATKVYGPAWPNHDKLSALNIRRSVDASLKRLGTDHIDLYQFHHVDRDTPWDEIWQAMDVLVRQGKILYVGSSNFAGWNIAQANETAARHGRLGLVSEQCLYNLCERRAEMEVVPAAREYGLGVIAWSPLHGGLLGGAIRKEQEALDPQQREQIQRYEDLLDKHGLEPGEVALAWLLTRPGVTGPIVGPRTADQLASAVRAAELTLTDEVLTALDEIFPGPGPSPEAFAW

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A three-level regulatory mechanism of the aldo-keto reductase subfamily AKR12D.
pubmed doi rcsb
molecule keywords Aldo/keto reductase
molecule tags Oxidoreductase
source organism Streptomyces xinghaiensis
total genus 115
structure length 299
sequence length 331
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2023-06-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.