8JXVD

Clozapine-bound h4r/gi complex
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
32
structure length
32
Chain Sequence
SKAAADLMAYCEAHAKEDPLLTPVPASENPFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Clozapine-bound H4R/Gi complex
rcsb
molecule tags Membrane protein
source organism Homo sapiens
molecule keywords Guanine nucleotide-binding protein G(i) subunit alpha-1
total genus 4
structure length 32
sequence length 32
ec nomenclature ec ?:
pdb deposition date 2023-07-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...