8JYWA

Cryo-em structure of the gasdermin pore from trichoplax adhaerens
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
250
structure length
250
Chain Sequence
RPMFAVAVNEFIRSAGQDSLCGVPDINSSGDFMPLHIIVKEVPKVLPCCRRPKIKRTPYTLNDILDEPCPNQLKSSDLVTFTEPLVSNVKASSSIGLQILKHFDSGAKGSKNFITSASLGTVVKAETIDITKVLAKVRTAKAKVENDLVSRVMKTKRLCLGLVVETACVAAAGKLTEADNWEISGHTNANIGEAVVTATAELDKNLSRKIEIPPGTALAYSFMDLEILEDRSLRVSSSAGAMFDSGKAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cleavage-independent activation of ancient eukaryotic gasdermins and structural mechanisms
doi rcsb
molecule tags Immune system
source organism Trichoplax adhaerens
molecule keywords Gasdermin pore forming domain-containing protein
total genus 42
structure length 250
sequence length 250
chains with identical sequence AA, AB, AC, B, BA, BB, BC, C, CA, CB, CC, D, DA, DB, DC, E, EA, EB, EC, F, FA, FB, FC, G, GA, GB, GC, H, HA, HB, HC, I, IA, IB, IC, J, JA, JB, JC, K, KA, KB, KC, L, LA, LB, M, MA, MB, N, NA, NB, O, OA, OB, P, PA, PB, Q, QA, QB, R, RA, RB, S, SA, SB, T, TA, TB, UA, UB, V, VA, VB, W, WA, WB, X, XA, XB, Y, YA, YB, Z, ZA, ZB
ec nomenclature
pdb deposition date 2023-07-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...