8K2LA

Crystal structure of group 4 monosaccharide-releasing beta-n-acetylgalactosaminidase ngap2 from paenibacillus sp. ts12, apo form
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
559
structure length
559
Chain Sequence
ELPDFETRCLSSLSKVFADAELHDLPVNTGSAMWKEVFSFQVAYRSPQLIKSLKISAESELEPYLAIRAVGLSPSELPVFPNPDEGYIRTAPGLYPDPLYPLADGVHAVPNQWRSVWVTVSLPSMSEFIPAADIGAESVSFPIDLCFEDGKGNHLGAEKFALEIIFQELPEQTLLHTEWFHSDCIATQYKVEVFSEAHWKLIESYVHNAVNHGVNMLLTPLFTPPLDTYVGGERPTVQLIDVEITGVNEYRFKFDRLERWVEMCQRLGIQFIEFSHLFTQWGAKYAPKIIAKKDGEEKRIFGWDTEASGESYSLFLDQFLPQLVHFIRNHHLDDKVFFHVSDEPGMKHAESYRQASDILNKHLAGFSILDALSDYDFYEKGLVQIPVPSNDQIEPFIEHGVEPLWTYYCCGQDHHVSNRFFSLSSPRNRVLGAQLYKFGVQGFLHWGFNFWYSQYSKKVIDPFKVTDADCAFPSGDPFVVYPGADGPLDSIRWEVFREGLQDLRALKLLEALAGREKTLALLEQNLREELTFKSFPDDIEWLLSTREKINRAIKDAYRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Genetic and functional diversity of beta-N-acetylgalactosamine residue-targeting glycosidases expanded by deep-sea metagenome
rcsb
molecule tags Hydrolase
source organism Paenibacillus sp. ts12
molecule keywords Monosaccharide-releasing beta-N-acetylgalactosaminidase
total genus 190
structure length 559
sequence length 559
ec nomenclature
pdb deposition date 2023-07-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...