8K42P

Structure of full banna virus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
249
structure length
249
Chain Sequence
MDVLSKGSLKELLAHLEKTPLEEAISYRIGTVPYQNVLISRNEYYNQLYPDTTSLIDGVSREGQRNVNGLIMSIISYVVSGSGHYIPNIGFMLLRRSILDILTKHDTGLVTNNLNYGIIARNLTVSKMNCEQRKRMLICFKLLAYKDGNQNDYEIYLNQNIPLKQIAPNFIPGDMRTVIHNQDQLAIVGIPAYRLTQSTELSIRDDNAKSYKLGYVDWYNSNSFLRERSEFNLIRLKDRDTKYGKLNGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-EM structures of Banna virus in multiple states reveal stepwise detachment of viral spikes.
pubmed doi rcsb
molecule keywords VP2
molecule tags Virus
total genus 66
structure length 249
sequence length 249
chains with identical sequence Q
ec nomenclature ec ?:
pdb deposition date 2023-07-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...