8K5RA

Cdk9/cyclin t1 in complex with kb-0742
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
323
structure length
305
Chain Sequence
YDDNECPFCDEVSKYEKLAKIEVFKARHRKTGQRVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLFYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLSQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELELVKGQKRKVKDRLAAYVRDPYALDLIDKLLVLDPAQRIDSEDALEHDFFWSDPMPSDLKGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of KB-0742, a Potent, Selective, Orally Bioavailable Small Molecule Inhibitor of CDK9 for MYC-Dependent Cancers.
pubmed doi rcsb
molecule tags Transcription
source organism Homo sapiens
molecule keywords Cyclin-dependent kinase 9
total genus 68
structure length 305
sequence length 323
ec nomenclature ec 2.7.11.22: cyclin-dependent kinase.
pdb deposition date 2023-07-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...