8K9OA

Crystal structure of cyanobacteriochrome rcae gaf domain in pg state
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
186
structure length
179
Chain Sequence
SAGLSMQAELRQQQQRVELFSEVTLKIRQSLQLKEILHTTVTEVQRILQADRVLIYHVLPDGTGKTISESVLPDYPTLMDLEFPQEVFPQEYQQLYAQGRVRAIADVHDPTAGLAECLVEFVDQFHIKAKLIVPIVQNQLWGLLIAHQCDSVRQWVDFELELMQQLADQISIALSQAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Green/red light-sensing mechanism in the chromatic acclimation photosensor
rcsb
molecule keywords histidine kinase
molecule tags Signaling protein
source organism Microchaete diplosiphon
total genus 64
structure length 179
sequence length 186
ec nomenclature
pdb deposition date 2023-08-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...