8KE9A

The cbd domain of cyanophage a-1(l) short tail fiber
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
218
Chain Sequence
DLSYVNTQLSADQVVLDALSSGKADLSYVNTQLNSKANLNGAVLVNATTATPPISDNDTSLATTQHVRSFNHSRLAFNAFRGGQQGVPSLSYVTTTAQFNSSSVRSGWGDNFSSNRWLVGEGGTYLITVTTRFATVGGTPPTYFDALLFVGLSGSGVENFLTRSQSVYPSFGYTLSWVGILTFNTGQNVFLNYQVNAVGGGSYSVVLEDVRFSGIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the intact tail machine of Anabaena myophage A-1(L).
pubmed doi rcsb
molecule tags Viral protein
molecule keywords Tail fiber protein
total genus 44
structure length 218
sequence length 218
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2023-08-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...