8KHPE

Cullin3-klhl22-rbx1 e3 ligase
Total Genus 3

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
72
structure length
52
Chain Sequence
AWDIVVDNCAICRNHIVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQK

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYO1 (35-37)Updating...
connected with : NaN
molecule tags Structural protein
source organism Homo sapiens
publication title Cryo-EM structure of the KLHL22 E3 ligase bound to an oligomeric metabolic enzyme.
pubmed doi rcsb
molecule keywords Kelch-like protein 22
total genus 3
structure length 52
sequence length 72
chains with identical sequence F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2023-08-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.