8OIED

Iron nitrogenase complex from rhodobacter capsulatus
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
272
structure length
272
Chain Sequence
TRKIAIYGKGGIGKSTTTQNTAAALAFFHEKNVFIHGCDPKADSTRLILGGLPQQTVMDTLRIEGAERVTVDKVVKTGFKDIRCVESGGPEPGVGCAGRGVITAIDLMEENEAYSEDLDFLFFDVLGDVVCGGFAMPIRDGKAEEVYIVASGEMMAIYAANNICKGLAKYARQSGVRLGGIICNSRNVDGEKEFLEEFTKAIGTKMIHFVPRDNIVQKAEFNKQTVTEFQPEANQAQEYRELGRKIIENEDFVIPKPLAMDELEAMVVKYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the iron nitrogenase complex
doi rcsb
molecule keywords Nitrogenase protein alpha chain
molecule tags Oxidoreductase
source organism Rhodobacter capsulatus sb 1003
total genus 91
structure length 272
sequence length 272
chains with identical sequence E, I, J
ec nomenclature ec 1.18.6.1: nitrogenase.
pdb deposition date 2023-03-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...