8OIQBq

39s mammalian mitochondrial large ribosomal subunit with mtrf1 and p-site trna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
122
structure length
122
Chain Sequence
GADRMSKWTSKRGPRTFCKGRGAKGTGFHGRDGKFVQIKEMIPELVVPELAGFKLKPYVNYRAPEGTDTPLTAKQLFLETAAPAIEKDFKAGTFDPEHLEKYGFEPTQEGKLFQLYPKNFPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords Mitochondrial ribosomal protein L12
publication title Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2023-03-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...