8OL9B

Anti-fixa fab in complex with human des-(gla-egf1) fixa
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
225
structure length
225
Chain Sequence
EVQLVESGGGLVQPGRSLRLSCAASGFIFDDYAMHWVRQVPGKGLEWVSGISWNSDNIGYVDSVKGRFTISRDNAKNSLYLQMNSLRIEDTALYYCAKAFGSGSYYNGFDYWGQGALVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Light chain of FIXa binding Fab
publication title Computational design of N-linked glycans for high throughput epitope profiling.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2023-03-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...